PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA031553-PA
Common NameOsI_34323
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Trihelix
Protein Properties Length: 692aa    MW: 71144 Da    PI: 5.4302
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA031553-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix99.62.6e-3195179187
          trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                       rW++qe+laL+++r++m+ ++r++ lk+plWeevs+k++e+g++rs+k+Ckek+en++k+yk++ke++ +r  ++ +t+++f+qlea
  BGIOSGA031553-PA  95 RWPRQETLALLKIRSDMDAAFRDATLKGPLWEEVSRKLAEEGYRRSAKKCKEKFENVHKYYKRTKESRAGR--NDGKTYRFFTQLEA 179
                       8********************************************************************97..56668*******85 PP

2trihelix111.55e-35380465187
          trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                       rW+k ev+aLi++r+++++r++++  k+plWee+s+ mr+ g++rs+k+Ckekwen+nk++kk+ke++kkr +e+s+tcpyf+ql+a
  BGIOSGA031553-PA 380 RWPKAEVHALIQLRSNLDNRYQEAGPKGPLWEEISAGMRRLGYSRSSKRCKEKWENINKYFKKVKESNKKR-PEDSKTCPYFHQLDA 465
                       8*********************************************************************8.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.0192154IPR001005SANT/Myb domain
PROSITE profilePS500906.73794152IPR017877Myb-like domain
CDDcd122032.21E-2894159No hitNo description
PfamPF138372.2E-2194180No hitNo description
SMARTSM007170.0087377439IPR001005SANT/Myb domain
PROSITE profilePS500907.317379437IPR017877Myb-like domain
PfamPF138376.9E-24379466No hitNo description
Gene3DG3DSA:1.10.10.603.6E-4379436IPR009057Homeodomain-like
CDDcd122035.99E-29380444No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010192Biological Processmucilage biosynthetic process
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 692 aa     Download sequence    Send to blast
MQQQQPGGGG GGVQQFGAVA PEMSPFSPAG GGGGGRISMA EAASPISSRP PPAQQQFDEL  60
GVGGGGGGGG GFDAEALAAA AVGEEGASGG AVGNRWPRQE TLALLKIRSD MDAAFRDATL  120
KGPLWEEVSR KLAEEGYRRS AKKCKEKFEN VHKYYKRTKE SRAGRNDGKT YRFFTQLEAL  180
HGTAAGVVAA PSPVTSLAPP PATAVGVSGG VRAPAEPPPA VVMGNVMSFS TSNTEEYSDE  240
EDSDDEGTED MGGGGGDERG KRKRLSEGGA AAGGGGGGGG GGGSGKMMRF FEGLVKQPPQ  300
PPPPPSHPTP ITSVAPAPPP PPPAAAAAAA SQPSPQATKS PLPATPQTQS SMDIVMTAAE  360
AHDAGYDGSG GGGGQPSSSR WPKAEVHALI QLRSNLDNRY QEAGPKGPLW EEISAGMRRL  420
GYSRSSKRCK EKWENINKYF KKVKESNKKR PEDSKTCPYF HQLDALYRNK AALNSSSSAA  480
AAAAPALPPP EHAEPAVTVA APISQTPPPP PPQPVTTTKN GNGTSSTNGA NGEGGGGGSG  540
GMQMQASNGS VVAGNKFFTG AAAKKPEDIM KEMMEQRPQQ PAAANNAFNR TDGGGGGGGV  600
DSDNMDEDDE DDYDDDDDDD DDDVDGNKMQ YEIQFQHQHH HQQPPQHRHQ QSVVRPNAAA  660
SAAAGGNPPG TAAPATAAAA TTTTGSFLAM VQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.883490.0flower| leaf| panicle| root| seed| stem
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00243DAPTransfer from AT1G76880Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8305450.0CT830545.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCFA218F06, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLB8BHW00.0B8BHW0_ORYSI; Uncharacterized protein
STRINGBGIOSGA031553-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60638175
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.18e-50Trihelix family protein